PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_115220_ueci.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 336aa    MW: 37657.1 Da    PI: 4.3655
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_115220_ueci.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.2e-1991144356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ eq++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Bv5_115220_ueci.t1  91 KKRRLSVEQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWK 144
                         56689************************************************9 PP

2HD-ZIP_I/II127.84.4e-4190181192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls eqv++LE+sFe e+kLeperKv+la++Lglqprqva+WFqnrRAR+ktkqlEkd+++L++++++lk++ ++L +e+e+L++e+
  Bv5_115220_ueci.t1  90 EKKRRLSVEQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDFDSLQSNFNNLKSDYDNLLQEKEKLQAEV 180
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                          
  Bv5_115220_ueci.t1 181 V 181
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-2074148IPR009057Homeodomain-like
PROSITE profilePS5007117.42786146IPR001356Homeobox domain
SMARTSM003893.7E-1989150IPR001356Homeobox domain
CDDcd000861.06E-1891147No hitNo description
PfamPF000462.2E-1691144IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-1993153IPR009057Homeodomain-like
PRINTSPR000319.8E-6117126IPR000047Helix-turn-helix motif
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PRINTSPR000319.8E-6126142IPR000047Helix-turn-helix motif
PfamPF021835.4E-15146187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MAGAGVGRVF SGSSGGVGAS LLYNSRLPSS SQSPDSFFIS GSSSNFLGSS SMVSFEDVYG  60
GKRSERPFFC TYDPDENGDE DFDDYFHQPE KKRRLSVEQV QFLEKSFEVE NKLEPERKVQ  120
LAKDLGLQPR QVAIWFQNRR ARWKTKQLEK DFDSLQSNFN NLKSDYDNLL QEKEKLQAEV  180
VHLSDKLLSK EKKQGDESEP SNTYVEPKIV EEEPIVDSAS DCEDHIVSVF GTKQDDLCSA  240
KSDVIDSDSS PHYVGANHSS FGEPGDSSYA FEADHSDISQ DDEDYLSKSL LPSSHVFSKM  300
GDVDYPNLPA NSCNYGLSGE DHASFFWPCW DINLKM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138146RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678585.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A0J8CEF80.0A0A0J8CEF8_BETVU; Uncharacterized protein
STRINGVIT_17s0000g05630.t011e-134(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-44homeobox 1